(data stored in ACNUC7421 zone)

EMBL: BA000007.FLHA

BA000007.FLHA        Location/Qualifiers
FT   CDS             complement(286245..287984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="ECs_0256"
FT                   /product="flagellar export pore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33680"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33680"
FT                   /db_xref="GOA:Q8X7Q2"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q2"
FT                   /protein_id="BAB33680.2"
FT                   /translation="MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSS
FT                   MAPRLAEDLSAALNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
     MLSRSDLLTL LTINFIVVTK GAERISEVSA RFTLDAMPGK QMAIDADLNA GLINQAQAQT        60
     RRKDVASEAD FYGAMDGASK FVRGDAIAGM MILAINLIGG VCIGIFKYNL SADAAFQQYV       120
     LMTIGDGLVA QIPSLLLSTA AAIIVTRVSD NGDIAHDVRH QLLASPSVLY TATGIMFVLA       180
     VVPGMPHLPF LLFSALLGFT GWRMSKQPQA AEAEEKSLET LTRTITETSE QQVSWETIPL       240
     IEPISLSLGY KLVALVDKAQ GNPLTQRIRG VRQVISDGNG VLLPEIRIRE NFRLKPSQYA       300
     IFINGIKADE ADIPADKLMA LPSSETYGEI DGVLGNDPAY GMPVTWIQPA QKAKALNMGY       360
     QVIDSASVIA THVNKIVRSY IPDLFNYDDI TQLHNRLSSM APRLAEDLSA ALNYSQLLKV       420
     YRALLTEGVS LRDIVTIATV LVASSAVTKD HILLAADVRL ALRRSITHPF VRKQELTVYT       480
     LNNELENLLT NVVNQAQQGG KVMLDSVPVD PNMLNQFQST MPQVKEQMKA AGKDPVLLVP       540
     PQLRPLLARY ARLFAPGLHV LSYNEVPDEL ELKIMGALS                              579
//

If you have problems or comments...

PBIL Back to PBIL home page