(data stored in ACNUC7421 zone)

EMBL: BA000007.FTSL

BA000007.FTSL        Location/Qualifiers
FT   CDS             95638..96003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECs_0087"
FT                   /product="membrane bound cell division leucine zipper
FT                   septum protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33510"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33510"
FT                   /db_xref="GOA:P0AEN6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AEN6"
FT                   /protein_id="BAB33510.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page