(data stored in ACNUC7421 zone)

EMBL: BA000007.GLNK

BA000007.GLNK        Location/Qualifiers
FT   CDS             538662..539000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="ECs_0504"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33927"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33927"
FT                   /db_xref="GOA:P0AC57"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AC57"
FT                   /protein_id="BAB33927.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
     MKLVTVIIKP FKLEDVREAL SSIGIQGLTV TEVKGFGRQK GHAELYRGAE YSVNFLPKVK        60
     IDVAIADDQL DEVIDIVSKA AYTGKIGDGK IFVAELQRVI RIRTGEADEA AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page