(data stored in ACNUC7421 zone)

EMBL: BA000007.GLTI

BA000007.GLTI        Location/Qualifiers
FT   CDS             complement(768200..769108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECs_0694"
FT                   /product="glutamate/aspartate periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34117"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34117"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XBL6"
FT                   /protein_id="BAB34117.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   DIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
     MQLRKPATAI LALALSAGLA QADDAAPAAG STLDKIAKNG VIVVGHRESS VPFSYYDNQQ        60
     KVVGYSQDYS NAIVEAVKKK LNKPDLQVKL IPITSQNRIP LLQNGTFDFE CGSTTNNVER       120
     QKQAAFSDTI FVVGTRLLTK KGGDIKDFAD LKGKAVVVTS GTTSEVLLNK LNEEQKMNMR       180
     IISAKDHGDS FRTLESGRAV AFMMDDALLA GERAKAKKPD NWDIVGKPQS QEAYGCMLRK       240
     DDPQFKKLMD DTIAQVQTSG EAEKWFDKWF KNPIPPKNLN MNFELSDEMK ALFKEPNDKA       300
     LN                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page