(data stored in ACNUC7421 zone)

EMBL: BA000007.GLTL

BA000007.GLTL        Location/Qualifiers
FT   CDS             complement(765891..766616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECs_0691"
FT                   /product="ATP-binding protein of glutamate/aspartate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:BAB34114"
FT                   /db_xref="EnsemblGenomes-Tr:BAB34114"
FT                   /db_xref="GOA:P0AAG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0AAG4"
FT                   /protein_id="BAB34114.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
     MITLKNVSKW YGHFQVLTDC STEVKKGEVV VVCGPSGSGK STLIKTVNGL EPVQQGEITV        60
     DGIVVNDKKT DLAKLRSRVG MVFQHFELFP HLSIIENLTL AQVKVLKRDK APAREKALKL       120
     LERVGLSAHA NKFPAQLSGG QQQRVAIARA LCMDPIAMLF DEPTSALDPE MINEVLDVMV       180
     ELANEGMTMM VVTHEMGFAR KVANRVIFMD EGKIVEDSPK DAFFDDPKSD RAKDFLAKIL       240
     H                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page