(data stored in ACNUC7421 zone)

EMBL: BA000007.GLXK

BA000007.GLXK        Location/Qualifiers
FT   CDS             634397..635542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECs_0576"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33999"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33999"
FT                   /db_xref="GOA:Q8XCW0"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XCW0"
FT                   /protein_id="BAB33999.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGITGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLVA
FT                   NGGNLARVASIEMEECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLRAVNLEQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     MKIVIAPDSF KESLSAEKCC QAIKAGFSTL FPDANYICLP IADGGEGTVD AMVAATGGNI        60
     VTLEVCGPMG EKVNAFYGIT GDGKTAVIEM AAASGLMLVA PEKRNPLLAS SFGTGELIRH       120
     ALDNGIRHII LGIGGSATVD GGMGMAQALG VRFLDADGQV LVANGGNLAR VASIEMEECD       180
     PRLANCHIEV ACDVDNPLVG ARGAAAVFGP QKGATPEMVE ELEQGLQNYA RVLQQQTEIN       240
     VCQMAGGGAA GGMGIAAAVF LNADIKPGIE IVLRAVNLEQ AVQGAALVIT GEGRIDSQTA       300
     GGKAPLGVAS VAKQFNVPVI GIAGVLGDGV EVVHQYGIDA VFSILPRLAP LAEVLASGET       360
     NLFNSARNIA CAIKIGQGIK N                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page