(data stored in ACNUC7421 zone)

EMBL: BA000007.HOFB

BA000007.HOFB        Location/Qualifiers
FT   CDS             complement(120204..121589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ECs_0111"
FT                   /product="type II secretion system protein HofB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33534"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33534"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X975"
FT                   /protein_id="BAB33534.1"
FT                   /translation="MNIPQLTALCLRYQGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVSQALDVNTLGMQPLQLAGFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPVNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
     MNIPQLTALC LRYQGVLLDA SEEVVHVAVV DAPSHELLDA LHFATTKRIE ITCWTRQQME        60
     GHASRTQQTL PVAVQEKHQP KAELLTRTLQ SALEQRASDI HIEPADNAYR IRLRIDGVLH       120
     PLPDVSPDAG VALTARLKVL GNLDIAEHRL PQDGQFTVEL AGNAVSFRIA TLPCRGGEKV       180
     VLRLLQQVSQ ALDVNTLGMQ PLQLAGFAHA LQQPQGLVLV TGPTGSGKTV TLYSALQKLN       240
     TADINICSVE DPVEIPIAGL NQTQIHPRAG LTFQGVLRAL LRQDPDVIMI GEIRDGETAE       300
     IAIKAAQTGH LVLSTLHTNS TCETLVRLQQ MGVARWMLSS ALTLVIAQRL VRKLCPHCRR       360
     QQGEPIHIPV NVWPSPLPHW QAPGCVHCYH GFYGRTALFE VLPITPVIRQ LISANTDVES       420
     LETHARQAGM RTLFENGCLA VEQGLTTFEE LIRVLGMPHG E                           461
//

If you have problems or comments...

PBIL Back to PBIL home page