(data stored in ACNUC7421 zone)

EMBL: BA000007.HOFC

BA000007.HOFC        Location/Qualifiers
FT   CDS             complement(119012..120214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ECs_0110"
FT                   /product="assembly protein in type IV pilin biogenesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33533"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33533"
FT                   /db_xref="GOA:Q8X977"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X977"
FT                   /protein_id="BAB33533.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQRAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWGWLLVL
FT                   FGIMLTIANKLLMRRPTWLIARQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNAGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNIAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     MASKQLWRWH GITGDGNAQD GMLWAESRTL LLMALQQQMV TPLSLKRIAI NSAQWRGDKS        60
     AEVIHQLATL LKAGLTLSEG LALLAEQHPS KQWQALLQSL AHDLEQGIAF SNALLPWSEV       120
     FPPLYQAMIR TGELTGKLDE CCFELARQQR AQRQLTDKVK SALRYPIIIL AMAIMVVVAM       180
     LHFVLPEFAA IYKTFNTPLP ALTQGIMTLA DFSGEWGWLL VLFGIMLTIA NKLLMRRPTW       240
     LIARQKLLLR IPIMGSLMRG QKLTQIFTIL ALTQSAGITF LQGVESVRET MRCPYWVQLL       300
     TQIQHDISNG HPIWLALKNA GEFSPLCLQL VRTGEASGSL DLMLDNIAHH HRDNTMALAD       360
     NLAALLEPAL LIITGGIIGT LVVAMYLPIF HLGDAMSGMG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page