(data stored in ACNUC7421 zone)

EMBL: BA000007.HTRE

BA000007.HTRE        Location/Qualifiers
FT   CDS             complement(157242..159842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECs_0143"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33566"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33566"
FT                   /db_xref="GOA:A0A0H3JFB9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JFB9"
FT                   /protein_id="BAB33566.1"
FT                   /translation="MYQFTHQKSRIPKKTLLAACCALFYSSNGAAADTVEYDSSFLMGT
FT                   GASTIDVKRYAQGNPTPPGLYNVRVFVNGQATSSLEIPFVDIGENSAAACLTHKNLAQL
FT                   HIKQPEQPVTLLAREGEEEDCLDLAKSYEKADVCFDGSDQFLDLTIPQAYVLKSYGGYV
FT                   DPSLWESGINAATLAYTLNAYHTSSDNDNSDSVYGAFNSGINLGAWHFRARGNYNWTTD
FT                   NGSDFDFQDRYLQRDIPAIRSQIIMGDAYTTGETFDSVNVRGVRLYSDSRMLPSALASY
FT                   APTIRGVANSNAKVTVTQSGYKIYETTVPPGEFVIDDISPSGFGSELVVTIEEADGSKR
FT                   TFTQPFSSVVQMQRPGVGRWDFSAGKVIDDSLRSEPNMGQASYYYGLNNLFTGYTGIQF
FT                   TDNNYLAGLLGVGINTSIGAFAVDVTHSRAEIPDDKTYQGQSYRVTWNKLFQDTGTSFN
FT                   LAAYRYSTQDYLGLHDALVLIDDAKHLSADEDKNTMQTYSRMKNQFTVSINQPLNIAYE
FT                   DYGSLFISGSWTYYWAANNSRTEYNVGYSKSVSWGSFSVNLQRSWNEDGEKDDAMYVSV
FT                   SVPIENILGGKRKSSGFRNLNTQLNTDFDGSHQLNVNSSGNTENNLVNYSVNAGYSLDK
FT                   NAGDLASVGGYLNYESGLGGISASASATSDNSQQYSISTDGGFVLHSGGLTFTNNSFSS
FT                   NDTLVLINALGAKGARINNSNNEIDRWGYAVTSSVSPYRENRVGLNIETLENDVELKST
FT                   SATTVPRSGSVVLTRFETDEGRSAVLNITAANGKSIPFAAEVYQGEVMIGSMGQGGQAF
FT                   VRGINDSGELIVRWYENNQTIDCKLHYQFPAQPQTQGSTNTLLLNNLTCQVANH"
     MYQFTHQKSR IPKKTLLAAC CALFYSSNGA AADTVEYDSS FLMGTGASTI DVKRYAQGNP        60
     TPPGLYNVRV FVNGQATSSL EIPFVDIGEN SAAACLTHKN LAQLHIKQPE QPVTLLAREG       120
     EEEDCLDLAK SYEKADVCFD GSDQFLDLTI PQAYVLKSYG GYVDPSLWES GINAATLAYT       180
     LNAYHTSSDN DNSDSVYGAF NSGINLGAWH FRARGNYNWT TDNGSDFDFQ DRYLQRDIPA       240
     IRSQIIMGDA YTTGETFDSV NVRGVRLYSD SRMLPSALAS YAPTIRGVAN SNAKVTVTQS       300
     GYKIYETTVP PGEFVIDDIS PSGFGSELVV TIEEADGSKR TFTQPFSSVV QMQRPGVGRW       360
     DFSAGKVIDD SLRSEPNMGQ ASYYYGLNNL FTGYTGIQFT DNNYLAGLLG VGINTSIGAF       420
     AVDVTHSRAE IPDDKTYQGQ SYRVTWNKLF QDTGTSFNLA AYRYSTQDYL GLHDALVLID       480
     DAKHLSADED KNTMQTYSRM KNQFTVSINQ PLNIAYEDYG SLFISGSWTY YWAANNSRTE       540
     YNVGYSKSVS WGSFSVNLQR SWNEDGEKDD AMYVSVSVPI ENILGGKRKS SGFRNLNTQL       600
     NTDFDGSHQL NVNSSGNTEN NLVNYSVNAG YSLDKNAGDL ASVGGYLNYE SGLGGISASA       660
     SATSDNSQQY SISTDGGFVL HSGGLTFTNN SFSSNDTLVL INALGAKGAR INNSNNEIDR       720
     WGYAVTSSVS PYRENRVGLN IETLENDVEL KSTSATTVPR SGSVVLTRFE TDEGRSAVLN       780
     ITAANGKSIP FAAEVYQGEV MIGSMGQGGQ AFVRGINDSG ELIVRWYENN QTIDCKLHYQ       840
     FPAQPQTQGS TNTLLLNNLT CQVANH                                            866
//

If you have problems or comments...

PBIL Back to PBIL home page