(data stored in ACNUC7421 zone)

EMBL: BA000007.HYXA

BA000007.HYXA        Location/Qualifiers
FT   CDS             complement(369563..370324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyxA"
FT                   /locus_tag="ECs_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33774"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33774"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X6D5"
FT                   /protein_id="BAB33774.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHRPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   HVISIANSSGGLSGLKHAENLPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNKFHGDGNALEKT
FT                   NAMTLRENGNTNRYSVVVNAGTQVLSLHKYK"
     MRFVLFCPSG IVPAQFAALS TGSVGNVTCI GTEEELRNKL RHRPQSVVIS AGRPAECAEM        60
     WFRFYRDHSF VVVLCVAPFF LPPDVSISGV LKNLRLLKPG MSVEHVISIA NSSGGLSGLK       120
     HAENLPVMDS YSVFMKEVNN RTKTIVMSER FPEKQKKVLS LLLAGHSWEY SAQFLKTGIR       180
     QIWLAEQSLK KRWGIPDSMS LREALLLSSN KFHGDGNALE KTNAMTLREN GNTNRYSVVV       240
     NAGTQVLSLH KYK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page