(data stored in ACNUC7421 zone)

EMBL: BA000007.ILVH

BA000007.ILVH        Location/Qualifiers
FT   CDS             91963..92454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECs_0082"
FT                   /product="acetolactate synthase 3 small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33505"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33505"
FT                   /db_xref="GOA:Q8X9Z5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X9Z5"
FT                   /protein_id="BAB33505.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLYKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     MRRILSVLLE NESGALSRVI GLFSQRGYNI ESLTVAPTDD PTLSRMTIQT VGDEKVLEQI        60
     EKQLYKLVDV LRVSELGQGA HVEREIMLVK IQASGYGRDE VKRNTEIFRG QIIDVTPSLY       120
     TVQLAGTSDK LDAFLASIRD VAKIVEVARS GVVGLSRGDK IMR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page