(data stored in ACNUC7421 zone)

EMBL: BA000007.ILVI

BA000007.ILVI        Location/Qualifiers
FT   CDS             90236..91960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECs_0081"
FT                   /product="acetolactate synthase 3 large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33504"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33504"
FT                   /db_xref="GOA:A0A0H3JBR8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBR8"
FT                   /protein_id="BAB33504.2"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIGH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGGAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPQELESKLSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     MEMLSGAEMV VRSLIDQGVK QVFGYPGGAV LDIYDALHTV GGIGHVLVRH EQAAVHMADG        60
     LARATGEVGV VLVTSGPGAT NAITGIATAY MDSIPLVVLS GQVATSLIGY DAFQECDMVG       120
     ISRPVVKHSF LVKQTEDIPQ VLKKAFWLAA SGRPGPVVVD LPKDILNPAN KLPYVWPESV       180
     SMRSYNPTTT GHKGQIKRAL QTLVAAKKPV VYVGGGAITA GCHQQLKETV EALNLPVVSS       240
     LMGLGAFPAT HRQALGMLGM HGTYEANMTM HNADVIFAVG VRFDDRTTNN LAKYCPNATV       300
     LHIDIDPTSI SKTVTADIPI VGDARQVLEQ MLELLSQESA HQPLDEIRDW WQQIEQWRAR       360
     QCLKYDTHSE KIKPQAVIET LWRLTKGGAY VTSDVGQHQM FAALYYPFDK PRRWINSGGL       420
     GTMGFGLPAA LGVKMALPEE TVVCVTGDGS IQMNIQELST ALQYELPVLV VNLNNRYLGM       480
     VKQWQDMIYS GRHSQSYMQS LPDFVRLAEA YGHVGIQISH PQELESKLSE ALEQVRNNRL       540
     VFVDVTVDGS EHVYPMQIRG GGMDEMWLSK TERT                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page