(data stored in ACNUC7421 zone)

EMBL: BA000007.IMP

BA000007.IMP         Location/Qualifiers
FT   CDS             complement(256527..257807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECs_0227"
FT                   /product="type VI secretion system protein ImpI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33650"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33650"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A152V9Q1"
FT                   /protein_id="BAB33650.1"
FT                   /translation="MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSV
FT                   QDRQQSIPAQAFTVILHDGTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMV
FT                   RVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVVNGF
FT                   SADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHN
FT                   DDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQR
FT                   NSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEAN
FT                   RAAIVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQ
FT                   GFEMLFNEVYAQVYDRVLREKQREPEA"
     MPEEKLQTLS LQVINGSELE SGRAARCLFT QQGNVGHAPE CHWSVQDRQQ SIPAQAFTVI        60
     LHDGTFCLRP QTAQLWLNQA KVTATSDLIQ LRQGDEIQIG RLMVRVHLNR GDIPHYDEEM       120
     ATPETIVTNR DMLTDTLLST EGAPHYPGMT HRHQLADTVV NGFSADPLQA LQSESLITTG       180
     DPLSGIAAVR PSAPLSDPAS NGGINTPFMD LPPIYASPGD HNDDISAAEM AQRHLAVTPL       240
     LRGLGGSLTV SNSDDADDFL EEAGRTLQAA IKGLLDLQQQ RNSLSDKHLR PLEDNPLRLN       300
     MDYATALDVM FAEGKSPVHL AAPAAVSESL RNVRHHEEAN RAAIVESLRV LLDAFSPQNL       360
     LRRFVQYRRS HELRQPLDDA GAWQMYSHYY EELASDRQQG FEMLFNEVYA QVYDRVLREK       420
     QREPEA                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page