(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPB

BA000007.IMPB        Location/Qualifiers
FT   CDS             complement(262937..263437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impB"
FT                   /locus_tag="ECs_0233"
FT                   /product="type VI secretion system protein ImpB"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33656"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33656"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T5"
FT                   /protein_id="BAB33656.1"
FT                   /translation="MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNT
FT                   QETSSLDERQAVSVNKHNFGAVMAEAAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDF
FT                   SPDSVARQVPEVNKLLELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQV
FT                   SNK"
     MSKKFEGSVA PRERINISYV PKTDGQTAEV ELPLNMLVVG DTGNTQETSS LDERQAVSVN        60
     KHNFGAVMAE AAIGLNFTVP ATLKGSTTDD EMNVALNIKS LDDFSPDSVA RQVPEVNKLL       120
     ELREALTALK GPMGNLPAFR TQLQALLENE ESREQLLKEI GQVSNK                      166
//

If you have problems or comments...

PBIL Back to PBIL home page