(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPC

BA000007.IMPC        Location/Qualifiers
FT   CDS             complement(261236..262627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impC"
FT                   /locus_tag="ECs_0231"
FT                   /product="type VI secretion system protein ImpC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33654"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33654"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T9"
FT                   /protein_id="BAB33654.1"
FT                   /translation="MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQG
FT                   VTAFIASILQSTASAEPVNKLAVDSMIADIDERISRQMDVIIHAPAFQQVESFWRSLKT
FT                   MVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQSGFYKHVYSSGFGQFGGEPIAAVL
FT                   GAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELPNIKDLYAIFEGP
FT                   AYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNTA
FT                   WMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREF
FT                   ELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAH
FT                   YIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEG
FT                   EPGWY"
     MSLQEEELVS SHAGQPEQES SLLDQIMAQT RIQPGSEGYD VARQGVTAFI ASILQSTASA        60
     EPVNKLAVDS MIADIDERIS RQMDVIIHAP AFQQVESFWR SLKTMVDRVD FRENIKVNVL       120
     HVTKQELLED FEFAPEIIQS GFYKHVYSSG FGQFGGEPIA AVLGAYEFKN TAPDMKLLQY       180
     VSAVGAMAHA PFLSSVSPEF MGLNSWTELP NIKDLYAIFE GPAYTKWRAL RDSEDSRYLG       240
     LTAPRFLLRQ PYSPTDNPVK NFNYYEDVSQ NHEDYLWGNT AWMLACNIAD SFAKYRWCPN       300
     IIGPQSGGAV KDLPVHLFET MGQIQAKIPT EVLVTDRREF ELAEEGFITL TMRKDSDNAA       360
     FFSANSVQKP KHFPGKDAET NYKLGTQLPY LFIINRLAHY IKVLQREQLG SWKERSDLER       420
     ELNTWIRQYV ADQENPPADV RSRKPLRAAK VEVMDVEGEP GWY                         463
//

If you have problems or comments...

PBIL Back to PBIL home page