(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPH

BA000007.IMPH        Location/Qualifiers
FT   CDS             complement(257832..258914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impH"
FT                   /locus_tag="ECs_0228"
FT                   /product="type VI secretion system protein ImpH"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33651"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33651"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U7"
FT                   /protein_id="BAB33651.1"
FT                   /translation="MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAEL
FT                   LHRLAKGEKGTPELSLRDDPAQETLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMG
FT                   LQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSHRLTQFVWHIWRKYRYHISFRNGG
FT                   VDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEIICGLVSHCFDLSE
FT                   VTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSIT
FT                   SLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLG
FT                   WTSFLGTPEERPSVTIRVRS"
     MDGKNRAASS YLSPGNPPAD KEQNDPLAQV FHNACSYNFF AMAELLHRLA KGEKGTPELS        60
     LRDDPAQETL RFSADASLAF PCSDISALKR DTSGAFRMTT TFMGLQGSQS PLPGYYLDHL       120
     AWKAVHEQSP VGDFLDMFSH RLTQFVWHIW RKYRYHISFR NGGVDAFSQR MYSLVGLGHR       180
     QLRDKLAINH SKMLAYSGIL ANPGRSPEII CGLVSHCFDL SEVTLQNWQR RKVDIEPDQQ       240
     NSLGSYSLKN GEKLAGRSVL GNFVLGTRVP DLSGKFQLSI TSLTRKQFLS FLPSGENFLP       300
     LTTFVSFILR DQLAWDLHLG LAPEQVGAMR LGDNKSALLG WTSFLGTPEE RPSVTIRVRS       360
//

If you have problems or comments...

PBIL Back to PBIL home page