(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPJ

BA000007.IMPJ        Location/Qualifiers
FT   CDS             complement(254672..256003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impJ"
FT                   /locus_tag="ECs_0225"
FT                   /product="type VI secretion system protein ImpJ"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33648"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33648"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V2"
FT                   /protein_id="BAB33648.1"
FT                   /translation="MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWG
FT                   FTELTLNNELLAQGKIMIDSASGTLPDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLA
FT                   LPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGDARTLTLGQLTPRIMSGAEDMSAY
FT                   ITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIG
FT                   SPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAELLGELMTFTEPSR
FT                   LPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQ
FT                   SATFVLAVAANMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYH
FT                   SGFSYFELDKSGQAWTEMAAAGAVALHVSGSFPDLNMQLWAIRG"
     MATTRNKVMW QEGMLMRPHH FQQQQRYNDY LDNQRFRAMN DLSWGFTELT LNNELLAQGK        60
     IMIDSASGTL PDGTVFSIPD QDALPDPLHP QNFPDERSRN IYLALPVASD VRNEISDGRR       120
     IGRYRLNYAD VRDLHSEEGD ARTLTLGQLT PRIMSGAEDM SAYITLPLCR ISDRHADGSL       180
     TLDDDFIPSC QNIQVSKKLR VYLKEVQGAI GGRASDLANR IGSPAQSGIA DVAEFMMLQL       240
     LNRNQTRFTH RARRSQLHPE DFYLDLAELL GELMTFTEPS RLPCPLDVYD HHDLTKTFKT       300
     LLPEVKRALH TVLSPRAVNL PLHLRDGIWQ ADVHDSELLQ SATFVLAVAA NMPVDQIQRQ       360
     FIQQSKISSP EKIRNMVSVQ IPGIPLRALM VAPRQLPYHS GFSYFELDKS GQAWTEMAAA       420
     GAVALHVSGS FPDLNMQLWA IRG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page