(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPK

BA000007.IMPK        Location/Qualifiers
FT   CDS             complement(253906..254667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impK"
FT                   /locus_tag="ECs_0224"
FT                   /product="type VI secretion system protein ImpK"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33647"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33647"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V4"
FT                   /protein_id="BAB33647.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTVKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
     MDEGSLSLPP FTGYDEKSLR DYHLALHGNS LNPMIDAATP LLGMVMRLST MNSQTMPEHL        60
     FAQVVTDVQA VEQLLQEQGY EPGVIISFRY ILCTFIDEAA LGNGWSNKNE WIKQSLLVHF       120
     HNEAWGGEKV FILLERLIRE PKRYQDLLEF LWLCFSLGFR GRYKVAVQDQ GEFEQIYRRL       180
     YHVLHKLRGD APFPLLHQDK KTQGGRYQLI SRLTVKHIFC GGVVVLALFY LFYLLRLDSQ       240
     TQDILHQLNK LLR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page