(data stored in ACNUC7421 zone)

EMBL: BA000007.IMPL

BA000007.IMPL        Location/Qualifiers
FT   CDS             complement(245399..248833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impL"
FT                   /locus_tag="ECs_0218"
FT                   /product="type VI secretion system protein ImpL"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33641"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33641"
FT                   /db_xref="GOA:A0A0H3JDE0"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDE0"
FT                   /protein_id="BAB33641.2"
FT                   /translation="MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIA
FT                   LVWLTVRVMKRLQLLEKQQKQQREEAIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLW
FT                   QLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARGTEQRLYLTPHVGKQAVIFDIDGT
FT                   LCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTADKRHREHLLQTLR
FT                   SRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDDW
FT                   RTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGEN
FT                   MNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQAL
FT                   LAEPNLATESRAWLMRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKA
FT                   FMDVPPPQGEDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTY
FT                   LQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRW
FT                   SEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKL
FT                   PVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYF
FT                   VKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNI
FT                   RNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQL
FT                   LTRLGHEFAPENITLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLR
FT                   LDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVMVEAVHYMEVDWRDSVVKPFN
FT                   EQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVII
FT                   REDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRN
FT                   YTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTV
FT                   RFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY"
     MLILAWIFLL VWIWWKGPTW TLYEEQWLKP LANRWLATAA WGIIALVWLT VRVMKRLQLL        60
     EKQQKQQREE AIDPLSVELN AQQRYLDRWL LRLQRHLDNR RFLWQLPWYM VIGPAGSGKT       120
     TLLREGFPSD IIYAPEGARG TEQRLYLTPH VGKQAVIFDI DGTLCAPADA DILHRRLWEH       180
     ALGWLKEKRA RQPLNGIILT LDLPDLLTAD KRHREHLLQT LRSRLQDIRQ HLHCQLPVYV       240
     VLTRLDLLQG FAALFQSLNR QDRDAILGVT FTRRAHENDD WRTELNAFWQ TWVDRMNLAL       300
     PDLMVTQTHT RASLFSFSRQ MQGSREPLVS LLEGLLDGEN MNVMLRGVYL TSSLQRGQMD       360
     DIFTQSAARQ YRLGNNPLAS WPLVDTAPYF TRSLFPQALL AEPNLATESR AWLMRSRRRL       420
     TVFSATGGVA ALLLITGWHH YYNGNYQSGI TVLKQAKAFM DVPPPQGEDD YGNLQLPLLN       480
     PVRDATLAYG DWGDRSRLAD MGLYQGRRIG PYVEQTYLQL LEQRYLPSLF NGLVKAMNAA       540
     PPESEEKLAV LRVMRMLEDK SGRNNEVVKQ YMAKRWSEKF HGQRDIQAQL MSHLDYALAH       600
     TDWHAERQAG DGDAISRWTP YDKPVVSAQK ELSKLPVYQR VYQSLKTRAL GVLPADLNLR       660
     DQVGPTFDQV FTSADDNKLV VPQFLTRYGL QSYFVKQRDE LVELTAMDSW VLNLTRSVKY       720
     SDADRAEIQR QLTEQYISDY TATWRAGMDN LNIRNFESIG QLTGALEQVI SGDQPLQRAL       780
     TVLRDNTQPG VFSEKLSAKE RDEALAEPDY QLLTRLGHEF APENITLAVQ KDKESTMQAV       840
     YQQLTELHRY LLAIQNAPVP GKSALKAVQL RLDQNSSDPI FATRQMAKTL PAPLNRWVGR       900
     LTDQAWHVVM VEAVHYMEVD WRDSVVKPFN EQLANNYPFN PRSAQDASLD AFERFFKPDG       960
     ILDTFYQQNL KLFIDNDLSL EDGDNNVIIR EDIIAQLETA QKIRDIFFSK QNGLGTSFAV      1020
     ETVSLSGNKR RSVLNLDGQL VDYSQGRNYT AHLVWPNNMR EGNESKLTLI GTSGNAPRSI      1080
     SFSGPWAQFR LFGAGQLTGV QDGNFTVRFS VDGGAMTYRV HTDTEDNPFS GGLFSQFGLS      1140
     DTLY                                                                   1144
//

If you have problems or comments...

PBIL Back to PBIL home page