(data stored in ACNUC7421 zone)

EMBL: BA000007.LAPB

BA000007.LAPB        Location/Qualifiers
FT   CDS             601826..603988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lapB"
FT                   /locus_tag="ECs_0543"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33966"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33966"
FT                   /db_xref="GOA:Q8XD16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD16"
FT                   /protein_id="BAB33966.2"
FT                   /translation="MKKNAQSVEAWLEAMIAVARYYRLDFSQENVRATVNWERDSKREE
FT                   LLTDMARQLGMGLRLVEFSADSLNPWRLPLIAVFDNQQIGVITRRDNHDNISVQFSGDE
FT                   GLETTLNVADIEDKIVELALLRPLSAIPDARVDDYIRPYQANWFWSLSLKDWRRYGDIM
FT                   LASLVANVLALAAMIFSMQVYDRVVPAQSYPTLWVLFAGVMMAILFEFCMRMVRTHLSD
FT                   VIGKRADLRISDRVFGHALRLKNNVRSKSTGSFISQIRELESVRELITSTTIGAVADLP
FT                   FFLLFVFILWMIGGWLVLVVLLALPLLVIPGLLVQRPLARLANEGMRESAVRNATLVEA
FT                   VQSIEDIKLLRAEQRFQNQWNHTNDVASSISMKQRFLTGLLLTWTQEVQSIVYVVVLLV
FT                   GCFMVMNGDMTTGALVGTTILASRTIAPLSQISGVLSRWQQAKVARNGLDELMKRPVDQ
FT                   PEHGKLVHKAVLHGNYQFSNAVFYYDEEEKIADVAIGKLNIQAGEKIAILGRNGAGKST
FT                   LLQMLAGMRIAQQGQVLLDNISIGQLDPADLRRDMGLLSQTGRLFFGSLRENLTMGMPE
FT                   ASDEDIERALTLSGALPFVQKQKNGLNYMIQEGGFGLSGGQRQTLLLARLLISQPNIVL
FT                   LDEPSASLDEMAEAYLIEQLKQWIGHRTLIIATHRTAMLQLVDRIIVMDQGRIVMDGAK
FT                   EAILREQGEPTARRVVLQEKNKGSAA"
     MKKNAQSVEA WLEAMIAVAR YYRLDFSQEN VRATVNWERD SKREELLTDM ARQLGMGLRL        60
     VEFSADSLNP WRLPLIAVFD NQQIGVITRR DNHDNISVQF SGDEGLETTL NVADIEDKIV       120
     ELALLRPLSA IPDARVDDYI RPYQANWFWS LSLKDWRRYG DIMLASLVAN VLALAAMIFS       180
     MQVYDRVVPA QSYPTLWVLF AGVMMAILFE FCMRMVRTHL SDVIGKRADL RISDRVFGHA       240
     LRLKNNVRSK STGSFISQIR ELESVRELIT STTIGAVADL PFFLLFVFIL WMIGGWLVLV       300
     VLLALPLLVI PGLLVQRPLA RLANEGMRES AVRNATLVEA VQSIEDIKLL RAEQRFQNQW       360
     NHTNDVASSI SMKQRFLTGL LLTWTQEVQS IVYVVVLLVG CFMVMNGDMT TGALVGTTIL       420
     ASRTIAPLSQ ISGVLSRWQQ AKVARNGLDE LMKRPVDQPE HGKLVHKAVL HGNYQFSNAV       480
     FYYDEEEKIA DVAIGKLNIQ AGEKIAILGR NGAGKSTLLQ MLAGMRIAQQ GQVLLDNISI       540
     GQLDPADLRR DMGLLSQTGR LFFGSLRENL TMGMPEASDE DIERALTLSG ALPFVQKQKN       600
     GLNYMIQEGG FGLSGGQRQT LLLARLLISQ PNIVLLDEPS ASLDEMAEAY LIEQLKQWIG       660
     HRTLIIATHR TAMLQLVDRI IVMDQGRIVM DGAKEAILRE QGEPTARRVV LQEKNKGSAA       720
//

If you have problems or comments...

PBIL Back to PBIL home page