(data stored in ACNUC7421 zone)

EMBL: BA000007.MBHA

BA000007.MBHA        Location/Qualifiers
FT   CDS             288079..288714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mbhA"
FT                   /locus_tag="ECs_0257"
FT                   /product="flagellar system protein MbhA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33679"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33679"
FT                   /db_xref="GOA:Q8X7Q3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Q3"
FT                   /protein_id="BAB33679.2"
FT                   /translation="MAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHM
FT                   EANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITG
FT                   HTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSA
FT                   GNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR"
     MAVPEETEKK ARDVNEKTAL LKKKSATELG ELATSINTIA RDAHMEANLE MEIVPQGLRV        60
     LIKDDQNRNM FERGSAQIMP FFKTLLVELA PVFDSLDNKI IITGHTDAMA YKNNIYNNWN       120
     LSGDRALSAR RVLEEAGMPE DKVMQVSAMA DQMLLDAKNP QSAGNRRIEI MVLTKSASDT       180
     LYQYFGQHGD KVVQPLVQKL DKQQVLSQRT R                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page