(data stored in ACNUC7421 zone)

EMBL: BA000007.MOKC

BA000007.MOKC        Location/Qualifiers
FT   CDS             complement(15419..15628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECs_0016"
FT                   /product="regulatory protein MokC for HokC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33439"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33439"
FT                   /db_xref="GOA:A0A0H3JC36"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="InterPro:IPR018084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JC36"
FT                   /protein_id="BAB33439.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKVMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
     MLNTCRVPLT DRKVKEKRAM KQHKVMIVAL IVICITAVVA ALVTRKDLCE VHIRTGQTEV        60
     AVFTAYESE                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page