(data stored in ACNUC7421 zone)

EMBL: BA000007.MSCK

BA000007.MSCK        Location/Qualifiers
FT   CDS             552602..555964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscK"
FT                   /locus_tag="ECs_0518"
FT                   /product="mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33941"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33941"
FT                   /db_xref="GOA:Q8XD54"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XD54"
FT                   /protein_id="BAB33941.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRVKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
     MTMFQYYKRS RHFVFSAFIA FVFVLLCQNT AFARASSNGD LPTKADLQAQ LDSLNKQKDL        60
     SAQDKLVQQD LTDTLATLDK IDRVKEETVQ LRQKVAEAPE KMRQATAALT ALSDVDNDEE       120
     TRKILSTLSL RQLETRVAQA LDDLQNAQND LASYNSQLVS LQTQPERVQN AMYNASQQLQ       180
     QIRSRLDGTD VGETALRPSQ KVLMQAQQAL LNAEIDQQRK SLEGNTVLQD TLQKQRDYVT       240
     ANSARLEHQL QLLQEAVNSK RLTLTEKTAQ EAVSPDEAAR IQANPLVKQE LEINQQLSQR       300
     LITATENGNQ LMQQNIKVKN WLERALQSER NIKEQIAVLK GSLLLSRILY QQQQTLPSAD       360
     ELENMTNRIA DLRLEQFEVN QQRDALFQSD AFVNKLEEGH TNEVNSEVHD ALLQVVDMRR       420
     ELLDQLNKQL GNQLMMAINL QINQQQLMSV SKNLKSILTQ QIFWVNSNRP MDWDWIKAFP       480
     QSLKDEFKSM KITVNWEKAW PAVFIAFLAG LPLLLIAGLI HWRLGWLKAY QQKLASAVGS       540
     LRNDSQLNTP KAILIDLIRA LPVCLIILAV GLILLTMQLN ISELLWSFSK KLAIFWLVFG       600
     LCWKVLEKNG VAVRHFGMPE QQTSHWRRQI VRISLALLPI HFWSVVAELS PLHLMDDVLG       660
     QAMIFFNLLL IAFLVWPMCR ESWRDKESHT MRLVTITVLS IIPIALMVLT ATGYFYTTLR       720
     LSGRWIETVY LVIIWNLLYQ TVLRGLSVAA RRIAWRRALA RRQNLVKEGA EGAEPPEEPT       780
     IALEQVNQQT LRITMLLMFA LFGVMFWAIW SDLITVFSYL DSITLWHYNG TEAGAAVVKN       840
     VTMGSLLFAI IASMVAWALI RNLPGLLEVL VLSRLNMRQG ASYAITTILN YIIIAVGAMT       900
     VFGSLGVSWD KLQWLAAALS VGLGFGLQEI FGNFVSGLII LFERPVRIGD TVTIGSFSGT       960
     VSKIRIRATT ITDFDRKEVI IPNKAFVTER LINWSLTDTT TRLVIRLGVA YGSDLEKVRK      1020
     VLLKAATEHP RVMHEPMPEV FFTAFGASTL DHELRLYVRE LRDRSRTVDE LNRTIDQLCR      1080
     ENDINIAFNQ LEVHLHNEKG DEVTEVKRDY KGDDPTPAVG                            1120
//

If you have problems or comments...

PBIL Back to PBIL home page