(data stored in ACNUC7421 zone)

EMBL: BA000007.PAOB

BA000007.PAOB        Location/Qualifiers
FT   CDS             complement(333340..334296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoB"
FT                   /locus_tag="ECs_0315"
FT                   /product="FAD-containing subunit of PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33738"
FT                   /db_xref="GOA:Q8X6J0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J0"
FT                   /protein_id="BAB33738.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLVAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYTFALVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDALFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
     MKAFTYERVN TPAEAALSAQ RVPGAKFIAG GTNLLDLMKL EIETPTHLID VNGLGLDKIE        60
     VTDAGGLRIG ALVRNTDLVA HERVRRDYAV LSRALLAGAS GQLRNQATTA GNLLQRTRCP       120
     YFYDTNQPCN KRLPGSGCAA LEGFSRQHAV VGVSEACIAT HPSDMAVAMR LLDAVVETIT       180
     PEGKTRSITL ADFYHPPGKT PHIETALLPG ELIVAVTLPP PLGGKHIYRK VRDRASYTFA       240
     LVSVAAIIQP DGSGRVALGG VAHKPWRIEA ADAQLSQGAQ AVYDALFASA HPTAENTFKL       300
     LLAKRTLASV LAEARAQA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page