(data stored in ACNUC7421 zone)

EMBL: BA000007.PAOC

BA000007.PAOC        Location/Qualifiers
FT   CDS             complement(331145..333343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paoC"
FT                   /locus_tag="ECs_0314"
FT                   /product="moco-containing subunit of PaoABC aldehyde
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33737"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33737"
FT                   /db_xref="GOA:Q8X6J4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8X6J4"
FT                   /protein_id="BAB33737.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEES
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITASNAGALSKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVSQPPEDTPDKNVG
FT                   DFDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQIDPADPTRRFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEPNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACVKLREMIASAVGFDPEQSQFADGKITNGTRSAILHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
     MKFDKPAGEN PIDQLKVVGR PHDRIDGPLK TTGTARYAYE WHEESPNAAY GYIVGSAIAK        60
     GRLTALDTDA AQKAPGVLPV ITASNAGALS KGDKNTARLL GGPTIEHYHQ AIALVVAETF       120
     EQARAAASLV QAHYRRNKGA YSLADEKQAV SQPPEDTPDK NVGDFDGAFS SAAVKIDATY       180
     TTPDQSHMAM EPHASMAVWD GNKLTLWTSN QMIDWCRTDL AKTLKVPVEN VRIISPYIGG       240
     GFGGKLFLRS DALLAALAAR AVKRPVKVML PRPSIPNNTT HRPATLQHLR IGADQSGKIT       300
     AISHESWSGN LPGGTPETAV QQSELLYAGA NRHTGLRLAT LDLPEGNAMR APGEAPGLMA       360
     LEIAIDELAE KAGIDPVEFR ILNDTQIDPA DPTRRFSRRQ LIECLRTGAD KFGWKQRNAT       420
     PGQVRDGEWL VGHGVAAGFR NNLLEKSGAR VHLEPNGTVT VETDMTDIGT GSYTILAQTA       480
     AEMLGVPLEQ VAVHLGDSSF PVSAGSGGQW GANTSTSGVY AACVKLREMI ASAVGFDPEQ       540
     SQFADGKITN GTRSAILHEA TAGGRLTAEE SIEFGTLSKE YQQSTFAGHF VEVGVHSATG       600
     EVRVRRMLAV CAAGRILNPK TARSQVIGAM TMGMGAALME ELAVDDRLGY FVNHDMAGYE       660
     VPVHADIPKQ EVIFLDDTDP ISSPMKAKGV GELGLCGVSA AIANAVYNAT GIRVRDYPIT       720
     LDKLLDKLPD VV                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page