(data stored in ACNUC7421 zone)

EMBL: BA000007.PE19

BA000007.PE19        Location/Qualifiers
FT   CDS             complement(19299..21749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0022"
FT                   /product="fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33445"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33445"
FT                   /db_xref="GOA:Q8XA56"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA56"
FT                   /protein_id="BAB33445.1"
FT                   /translation="MLRTTRWVAAIIFLYSFPGYAEETFDTHFMIGGMKGEKVSEYHFD
FT                   NKQPLPGNYELDFYVNNQWRGKQDITIPESPVKPCLPKVLLTKLGVKTGNLNTEDNCIL
FT                   LDKAVHGGQYQWDISEHRLNLTVPQAYINELERGYVPPESWDRGIDAFYTSYNLSQYRS
FT                   YDSNNNSNTASYGRFNSGLNLFSWQLHSDASYSKPDDMKGTWQSNTLYLEHGWSQILST
FT                   VQIGENYTSSLIFDSLRFSGIRLFRDMQMLPDSMQSFTPLVQGVAQSNALITVSQNGYI
FT                   IYQKEVPPGPFTIADLQLSGSGSDLDVSIKEADGSVRSFLVPYSSVPNMLQPGISNFDF
FT                   IAGRSKIYGVKNQEDFLEANYIYGLNNLLTLYGGTILSDNYNAITLGNGWNTPLGAISF
FT                   DATRSSSKLNNDITHEGTSYQVAYNKYLVQTATRFSVAAWRYASQDYRTFSDHLYENDK
FT                   INHQSDYDDFYDIGRKNSLSANIMQPLSNNLGNVSLSALWRNYWGRSGNAKDYQFSYSN
FT                   SWQRISYTFSASQSYDENDKEEERFNLFISIPFYWGDDIAKTRHQINLSNSTSFSKDGY
FT                   SSNNTGITGIAGEHDQLNYGIYVNQQQQNNDTSLGTNLSWRTPIATIDGSYSHSKNAWQ
FT                   SGGSISSGLVVWPGGINITNQLSDTFAILDAPGLEGAHINGQKYNRTNSKGQVVYDLMI
FT                   PHRENHLVLDTANSESETELQGNRQIIAPYRGAVSYVQFTTDQRKPWYIQALRPDGSPL
FT                   TFGYDVLDLQENNIGVVGQGSRLFIRVDEIPTGIKVALNDEQNLFCTITFQHVIDENKT
FT                   YICQ"
     MLRTTRWVAA IIFLYSFPGY AEETFDTHFM IGGMKGEKVS EYHFDNKQPL PGNYELDFYV        60
     NNQWRGKQDI TIPESPVKPC LPKVLLTKLG VKTGNLNTED NCILLDKAVH GGQYQWDISE       120
     HRLNLTVPQA YINELERGYV PPESWDRGID AFYTSYNLSQ YRSYDSNNNS NTASYGRFNS       180
     GLNLFSWQLH SDASYSKPDD MKGTWQSNTL YLEHGWSQIL STVQIGENYT SSLIFDSLRF       240
     SGIRLFRDMQ MLPDSMQSFT PLVQGVAQSN ALITVSQNGY IIYQKEVPPG PFTIADLQLS       300
     GSGSDLDVSI KEADGSVRSF LVPYSSVPNM LQPGISNFDF IAGRSKIYGV KNQEDFLEAN       360
     YIYGLNNLLT LYGGTILSDN YNAITLGNGW NTPLGAISFD ATRSSSKLNN DITHEGTSYQ       420
     VAYNKYLVQT ATRFSVAAWR YASQDYRTFS DHLYENDKIN HQSDYDDFYD IGRKNSLSAN       480
     IMQPLSNNLG NVSLSALWRN YWGRSGNAKD YQFSYSNSWQ RISYTFSASQ SYDENDKEEE       540
     RFNLFISIPF YWGDDIAKTR HQINLSNSTS FSKDGYSSNN TGITGIAGEH DQLNYGIYVN       600
     QQQQNNDTSL GTNLSWRTPI ATIDGSYSHS KNAWQSGGSI SSGLVVWPGG INITNQLSDT       660
     FAILDAPGLE GAHINGQKYN RTNSKGQVVY DLMIPHRENH LVLDTANSES ETELQGNRQI       720
     IAPYRGAVSY VQFTTDQRKP WYIQALRPDG SPLTFGYDVL DLQENNIGVV GQGSRLFIRV       780
     DEIPTGIKVA LNDEQNLFCT ITFQHVIDEN KTYICQ                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page