(data stored in ACNUC7421 zone)

EMBL: BA000007.PE209

BA000007.PE209       Location/Qualifiers
FT   CDS             complement(241872..242168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33635"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33635"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7Y3"
FT                   /protein_id="BAB33635.1"
FT                   /translation="MIIINLRLTLLFILATFTYSVQSDEFDDQTTYTQYRYFSTAIPED
FT                   IRRFMFYVDYCFVDLAFDIETDSMTAKNDIINECTPLKERNKTLKEKYKKMKR"
     MIIINLRLTL LFILATFTYS VQSDEFDDQT TYTQYRYFST AIPEDIRRFM FYVDYCFVDL        60
     AFDIETDSMT AKNDIINECT PLKERNKTLK EKYKKMKR                                98
//

If you have problems or comments...

PBIL Back to PBIL home page