(data stored in ACNUC7421 zone)

EMBL: BA000007.PE21

BA000007.PE21        Location/Qualifiers
FT   CDS             complement(22495..23028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0024"
FT                   /product="fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33447"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33447"
FT                   /db_xref="GOA:Q8XA52"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8XA52"
FT                   /protein_id="BAB33447.1"
FT                   /translation="MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNG
FT                   DSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANN
FT                   FTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTK
FT                   GSVESTVTIKISAD"
     MKKYIIPFVA TTLMFSATTF AKDVDQGTLT IRGEVVDTTC YFVNGDSTTD IVVEDVVTSA        60
     MNQLINNEIY TLKTGSTSHD LEIQCDGNTA PSIEVLASEF DANNFTLNKG TAENIGFAIF       120
     LDDGTLTRMR PGLKTPLKDN GSGQYFLNLN AQYARTSGNP VTKGSVESTV TIKISAD          177
//

If you have problems or comments...

PBIL Back to PBIL home page