(data stored in ACNUC7421 zone)

EMBL: BA000007.PE210

BA000007.PE210       Location/Qualifiers
FT   CDS             complement(242165..242614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33636"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDD6"
FT                   /protein_id="BAB33636.1"
FT                   /translation="MRKITIILLLTFSCTKGLAFDISMSKECSGVDELEFIDCVKNSFI
FT                   MSTITLKKAEANIKEKIQKWNSDEDEAIRKEAVISLKRLESSNREFIRYRFAQCSFTLT
FT                   WGARVGRLAFSRLYPCYTELNKIRAMQLNNAYISDFQNPDEISSK"
     MRKITIILLL TFSCTKGLAF DISMSKECSG VDELEFIDCV KNSFIMSTIT LKKAEANIKE        60
     KIQKWNSDED EAIRKEAVIS LKRLESSNRE FIRYRFAQCS FTLTWGARVG RLAFSRLYPC       120
     YTELNKIRAM QLNNAYISDF QNPDEISSK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page