(data stored in ACNUC7421 zone)

EMBL: BA000007.PE211

BA000007.PE211       Location/Qualifiers
FT   CDS             complement(242617..243213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33637"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33637"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X8"
FT                   /protein_id="BAB33637.2"
FT                   /translation="MLWTENDAENTSQWNGYPLQIGRFRKDKAMPALISGEKSTALVTP
FT                   PQWRNKAFNGLKDPERNYWAKEQITGSPEENIKAAITYLMMKLSNTKEESTIDQYDSTL
FT                   YSAIVQKGDLADNIRKERKTTIPNLTKNNPGKNLDKIHPGDILYYQKASMKVIITGWKP
FT                   ITIKNVAMNYNGGGDPKYAIKLQFVYTLLTKNRVL"
     MLWTENDAEN TSQWNGYPLQ IGRFRKDKAM PALISGEKST ALVTPPQWRN KAFNGLKDPE        60
     RNYWAKEQIT GSPEENIKAA ITYLMMKLSN TKEESTIDQY DSTLYSAIVQ KGDLADNIRK       120
     ERKTTIPNLT KNNPGKNLDK IHPGDILYYQ KASMKVIITG WKPITIKNVA MNYNGGGDPK       180
     YAIKLQFVYT LLTKNRVL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page