(data stored in ACNUC7421 zone)

EMBL: BA000007.PE213

BA000007.PE213       Location/Qualifiers
FT   CDS             complement(243534..244013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0216"
FT                   /product="type VI secretion system effector Hcp1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33639"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33639"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7X3"
FT                   /protein_id="BAB33639.1"
FT                   /translation="MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFM
FT                   HGLNRDQNVNHHHLTIKKPIDKASPLLGKAICDNELLTCDFSFYRTNKFGINELFYKIK
FT                   LTGAKISDIHVSISHIVVDNSVQPEESVSFSYESIIWEHCSAGTSAYSLWEDRLF"
     MANLIYLTLN GDNQGLISSG CSSQPSIGNK AQTAHIDQIM IYEFMHGLNR DQNVNHHHLT        60
     IKKPIDKASP LLGKAICDNE LLTCDFSFYR TNKFGINELF YKIKLTGAKI SDIHVSISHI       120
     VVDNSVQPEE SVSFSYESII WEHCSAGTSA YSLWEDRLF                              159
//

If you have problems or comments...

PBIL Back to PBIL home page