(data stored in ACNUC7421 zone)

EMBL: BA000007.PE214

BA000007.PE214       Location/Qualifiers
FT   CDS             complement(243979..245388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33640"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33640"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JBT0"
FT                   /protein_id="BAB33640.1"
FT                   /translation="MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLV
FT                   ESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPA
FT                   RTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLL
FT                   YFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVR
FT                   SLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAAT
FT                   VWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALK
FT                   TRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESL
FT                   LTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVL
FT                   NGEFNLFNTKW"
     MNSNVLTQTI VTGSDPRGLP EFSAIREEIN KASHPSQPEL NWKLVESLAL AIFKANGVDL        60
     HTATYYTLAR TRTQGLAGFC EGAELLAAMV SHDWDKFWPQ GGPARTEMLD WFNSRTGNIL       120
     RQQISFAESD LPLIYRTERA LQLICDKLQQ VELKRVPRVE NLLYFMQNTR KRLEPQLKSN       180
     TENAAQTTVR TLIYAPETQA SSTPEAVVPP LPGLPEMKVE VRSLTENPPQ ASVIKQGSTV       240
     RGFIAGIACS VAVASALWWW QVYPVQQQLL QVNDTAQGAA TVWMASPELE NYERRLQQLL       300
     DTSPVQPLET GMQMMRVADS RWPESLQQQQ ASTQWNEALK TRAQSSPQLR GWLQTRQDLH       360
     AFADLVMQRE KEGLTLSYIK NVIWQAERGL GQETPVESLL TQYQDARAQK QNTDALEKQI       420
     NERLEGVLSR WLLLKNNTIP TIKKALNFNN IHEYKGVLNG EFNLFNTKW                   469
//

If you have problems or comments...

PBIL Back to PBIL home page