(data stored in ACNUC7421 zone)

EMBL: BA000007.PE217

BA000007.PE217       Location/Qualifiers
FT   CDS             complement(250386..251129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0222"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33645"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33645"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7V9"
FT                   /protein_id="BAB33645.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDHLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADSRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
     MSRLRVFRQT GWFIAGLMTG LPATAAPAEA SSMAGVAVAV ATTTPPDATA TLQAMQSCRR        60
     ESAALERLDC YDHLLAPLSP SGFDGALVKA GFVGEAWTRA TEQEKRREGN TTELLVTQVP       120
     GERPTVVITT PAIGHVPPRP VLMFSCVDNI TRMQVALMHP LDVHDIAVTL NADSRALRSH       180
     WFVRENGTLL ESSRGLSGID EIKQLFGAKT LTVDTGADNA AGKLTFNIDG LARAIAPLRD       240
     ACHWAGE                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page