(data stored in ACNUC7421 zone)

EMBL: BA000007.PE224

BA000007.PE224       Location/Qualifiers
FT   CDS             complement(258878..260728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0229"
FT                   /product="type VI secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33652"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33652"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7U6"
FT                   /protein_id="BAB33652.1"
FT                   /translation="MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERL
FT                   LEGVAFLTGNLRQKIEDEFPELTHGLIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLI
FT                   PRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLCRDIWLLPVRLEQIENRSTTRNGV
FT                   INITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGADLTVGEQHIRLP
FT                   EFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEFF
FT                   TLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQH
FT                   YDVFSVNSVVSQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRT
FT                   KTSLFHRGFDHTLAFIHADGSYPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTG
FT                   KNAAVASFRNITRPTQPLWPVIDGSLHWSLLSAMNLNYLSLLDTDALKQVIANFDRHAI
FT                   HHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLHPEPFVCEGEMYLLGTV
FT                   LSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI"
     MEFEERYFRE ELDYLRQLSK LLATEKPHLA RFLAEKDADP DIERLLEGVA FLTGNLRQKI        60
     EDEFPELTHG LIKMLWPNYL RPVPAMTLIE YTPDMDKSSV PVLIPRNEQF TTNAGEIRVD       120
     EVLPSDAKKE EPPPCTFTLC RDIWLLPVRL EQIENRSTTR NGVINITFSV APGTDFRTLD       180
     LNKLRFWLGN DDNYTRDQLY LWFCEYLQGA DLTVGEQHIR LPEFMLKAVG FEPQDAMLPW       240
     PKNVHSGYRI LQEYFCYPDA FLFFDLCGCP ALPDGLQAEF FTLQLRFSRP LPVDIRLRRD       300
     SLRLYCAPAI NLFIHHAEAI TLDNRRADYP LVPSRHYPQH YDVFSVNSVV SQVQDMFRKK       360
     DLGRPVSTQA ARQWPAFESF SHQMEYSRKR EVVYWHHRTK TSLFHRGFDH TLAFIHADGS       420
     YPSDESLLSN EVVSVSLTCT NRELPSQIRS GDITGTTGKN AAVASFRNIT RPTQPLWPVI       480
     DGSLHWSLLS AMNLNYLSLL DTDALKQVIA NFDRHAIHHP QTARLSQQKL DAIERLETRP       540
     VDRLFTGIPV RGLASTLYLH PEPFVCEGEM YLLGTVLSHF LSLYASVNSF HMLTVVNTES       600
     QETWKWTERI GQHPLI                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page