(data stored in ACNUC7421 zone)

EMBL: BA000007.PE227

BA000007.PE227       Location/Qualifiers
FT   CDS             complement(262678..262902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33655"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33655"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7T7"
FT                   /protein_id="BAB33655.1"
FT                   /translation="MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTL
FT                   DRRISDLLDEIIHFCEFQQSASHWQRVLH"
     MTAHKNISGT YHLSVADILQ VVYQVCFSPS VEINQDGVAA LITTLDRRIS DLLDEIIHFC        60
     EFQQSASHWQ RVLH                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page