(data stored in ACNUC7421 zone)

EMBL: BA000007.PE229

BA000007.PE229       Location/Qualifiers
FT   CDS             264134..264652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0234"
FT                   /product="Hcp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33657"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33657"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DC35"
FT                   /protein_id="BAB33657.1"
FT                   /translation="MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFL
FT                   HNVTVPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVE
FT                   GKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGA
FT                   DDWRAPLEA"
     MPTPCYISIT GQTQGNITAG AFTADSVGNI YVQGHEDEML VQEFLHNVTV PTDPQSGQPA        60
     GQRAHKPFIF TVALNKAVPL MYNALASGEM LPTTELHWWR TSVEGKQEHY FTTRLTDSTI       120
     VDMKLHMPHC QDPAKREFTQ LLEVSLAYRK IEWEHVKSGT SGADDWRAPL EA               172
//

If you have problems or comments...

PBIL Back to PBIL home page