(data stored in ACNUC7421 zone)

EMBL: BA000007.PE234

BA000007.PE234       Location/Qualifiers
FT   CDS             273792..275552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0242"
FT                   /product="type IV secretion protein Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33665"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33665"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R9"
FT                   /protein_id="BAB33665.1"
FT                   /translation="MPWLHRETARSFGGAGSTAGYEQVTAYTLTGQLQSRHLNLPQLDC
FT                   DYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDIPYATDPAGNRLPDPE
FT                   LHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLTEKTDRIPEGVIRMHDERTHHYHYDNQH
FT                   RLVFYTRIQYGEPLVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEVTWYGWDGD
FT                   RLTTVQTGTTRIQTVYRPGSFTPLIRIETENGEREKAQRRSLAEKLQQEGSEDGHGVVF
FT                   PAELVRMLDRLEEEIRADRVSSESRAWLAQCGLTVEQLEKQVEPEYTPARTLHLYHCDH
FT                   RGLPLALISEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQHDEESGLYYNRHRY
FT                   YDPLQGRYITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGL
FT                   IVANSITNSAYQFGYDMDAIVGGAHNGAADAMRYCYLMCRMTKTFGSTIADVIGKNHEA
FT                   AGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNIGQLFGLDGIKADNPIKA
FT                   KQGSSDASNY"
     MPWLHRETAR SFGGAGSTAG YEQVTAYTLT GQLQSRHLNL PQLDCDYDWN DNGQLIRISG        60
     PQESREYRYS DTGRLTGVHT TAANLDIDIP YATDPAGNRL PDPELHPDST LTAWPDNRIA       120
     EDAHYVYRYD EYGRLTEKTD RIPEGVIRMH DERTHHYHYD NQHRLVFYTR IQYGEPLVES       180
     RYLYDPLGRR TGKRVWRRER DLTGWMSLSR KPEVTWYGWD GDRLTTVQTG TTRIQTVYRP       240
     GSFTPLIRIE TENGEREKAQ RRSLAEKLQQ EGSEDGHGVV FPAELVRMLD RLEEEIRADR       300
     VSSESRAWLA QCGLTVEQLE KQVEPEYTPA RTLHLYHCDH RGLPLALISE DGNTAWSAEY       360
     DEWGNQLNEE NPHHLHQPYR LPGQQHDEES GLYYNRHRYY DPLQGRYITP DPIGLRGGWN       420
     MYQYPLNPIQ VIDPMGLDAI ENMTSGGLIY AVSGVPGLIV ANSITNSAYQ FGYDMDAIVG       480
     GAHNGAADAM RYCYLMCRMT KTFGSTIADV IGKNHEAAGD RQGQPAKERI MDLKNNTVGI       540
     ACGDFSAKCS DACIEKYNIG QLFGLDGIKA DNPIKAKQGS SDASNY                      586
//

If you have problems or comments...

PBIL Back to PBIL home page