(data stored in ACNUC7421 zone)

EMBL: BA000007.PE235

BA000007.PE235       Location/Qualifiers
FT   CDS             275536..275706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33666"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33666"
FT                   /db_xref="GOA:A0A0H3JDG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDG1"
FT                   /protein_id="BAB33666.1"
FT                   /translation="MLQIIRGKLVIFLITLCLFVVYLGFDNNSNSDIVFYGHKTPKSVE
FT                   IYLSEKILFIK"
     MLQIIRGKLV IFLITLCLFV VYLGFDNNSN SDIVFYGHKT PKSVEIYLSE KILFIK            56
//

If you have problems or comments...

PBIL Back to PBIL home page