(data stored in ACNUC7421 zone)

EMBL: BA000007.PE236

BA000007.PE236       Location/Qualifiers
FT   CDS             275754..276017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33667"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33667"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7R7"
FT                   /protein_id="BAB33667.1"
FT                   /translation="MVNNYKTHCGVVDINLNFFNDILYSVRLKNISKLENMEFCATKQR
FT                   VYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
     MVNNYKTHCG VVDINLNFFN DILYSVRLKN ISKLENMEFC ATKQRVYFSD KNKKASYKII        60
     NYGDYYDVDY YDNNLKNEVF DWIGKWS                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page