(data stored in ACNUC7421 zone)

EMBL: BA000007.PE266

BA000007.PE266       Location/Qualifiers
FT   CDS             complement(301940..302653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0274"
FT                   /product="phage repressor protein CI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33697"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33697"
FT                   /db_xref="GOA:Q8X7M5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7M5"
FT                   /protein_id="BAB33697.1"
FT                   /translation="MSAKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
FT                   SGVGALFNGINALNAYNAALLAKILNVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
FT                   PVFSHVQAGMFSPELRTFTKGDAEKWVSTTKKASGSAFWLEVEGNSMTAPTGSKPSFPD
FT                   GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV
FT                   VGKVIASQWPEETFG"
     MSAKKKPLTQ EQLEDARRLK AIYEKKKNEL GLSQESVADK MGMGQSGVGA LFNGINALNA        60
     YNAALLAKIL NVSVEEFSPS IAREIYEMYE AVSMQPSLRS EYEYPVFSHV QAGMFSPELR       120
     TFTKGDAEKW VSTTKKASGS AFWLEVEGNS MTAPTGSKPS FPDGMLILVD PEQAVEPGDF       180
     CIARLGGDEF TFKKLIRDSG QVFLQPLNPQ YPMIPCNESC SVVGKVIASQ WPEETFG          237
//

If you have problems or comments...

PBIL Back to PBIL home page