(data stored in ACNUC7421 zone)

EMBL: BA000007.PE271

BA000007.PE271       Location/Qualifiers
FT   CDS             304629..305423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0280"
FT                   /product="phage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33703"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33703"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JDH9"
FT                   /protein_id="BAB33703.1"
FT                   /translation="MAKNDFKAFATDRNANVMSQEEWEALPALISGFTAGKASSAQVNK
FT                   VIRQASFIAAALAQFVSDKTQRDVLDNGDLPGFVELLGSGFAVEYLSRKNPFGDIKSDG
FT                   TVKTALQNLGLGEGAPAIGVPFFWPSAAMPNTVIDSWSCMVFLKFNGAKFSATDYPVLA
FT                   KVFPSLVLPEARGDFIRIWDDGRGADGGRELLSWQAATNFSQFAGNIGEGAGHAINFHD
FT                   GIAGNQPGFSRFNFTSNSVGDGVNFVAVRPRNIAFNFLVRAK"
     MAKNDFKAFA TDRNANVMSQ EEWEALPALI SGFTAGKASS AQVNKVIRQA SFIAAALAQF        60
     VSDKTQRDVL DNGDLPGFVE LLGSGFAVEY LSRKNPFGDI KSDGTVKTAL QNLGLGEGAP       120
     AIGVPFFWPS AAMPNTVIDS WSCMVFLKFN GAKFSATDYP VLAKVFPSLV LPEARGDFIR       180
     IWDDGRGADG GRELLSWQAA TNFSQFAGNI GEGAGHAINF HDGIAGNQPG FSRFNFTSNS       240
     VGDGVNFVAV RPRNIAFNFL VRAK                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page