(data stored in ACNUC7421 zone)

EMBL: BA000007.PE276

BA000007.PE276       Location/Qualifiers
FT   CDS             complement(307504..308277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33708"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33708"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7L0"
FT                   /protein_id="BAB33708.1"
FT                   /translation="MDITEFPSGVIEHLGWYVYRLIDPRDGSTFYVGKGKGNRVFAHMR
FT                   GEVAAADDDDLLSNKLKQIREIRLAGLEVIHVIHRHGMTDEKTAYEVEAALIDAYPGLT
FT                   NIMNGAGSNEFGAAHVKELIATYQPETITFHHKALMISVNRSAKDSELYDAVRFSWRIN
FT                   VSRASKAEVILATVRGIVRGVFIADKWLKSTREHFPTMKYWDEDPDFEATQSSRYGFEG
FT                   REAPPEIANLYLGKKIPDELRKKGAMSPVRYSPNF"
     MDITEFPSGV IEHLGWYVYR LIDPRDGSTF YVGKGKGNRV FAHMRGEVAA ADDDDLLSNK        60
     LKQIREIRLA GLEVIHVIHR HGMTDEKTAY EVEAALIDAY PGLTNIMNGA GSNEFGAAHV       120
     KELIATYQPE TITFHHKALM ISVNRSAKDS ELYDAVRFSW RINVSRASKA EVILATVRGI       180
     VRGVFIADKW LKSTREHFPT MKYWDEDPDF EATQSSRYGF EGREAPPEIA NLYLGKKIPD       240
     ELRKKGAMSP VRYSPNF                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page