(data stored in ACNUC7421 zone)

EMBL: BA000007.PE280

BA000007.PE280       Location/Qualifiers
FT   CDS             311992..312408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33713"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33713"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K6"
FT                   /protein_id="BAB33713.1"
FT                   /translation="MSQPLSEILTWDDEQWEVFVHDWLIVCKSDDYPWSERLGGAGDKG
FT                   RDVVGYKSDPNVEGYSWDNYQCKLYKKSLGFSDVVVEFGKLIYFTLNGDYPIPQKYFFV
FT                   APYDLSTTFSNLLKNKNELKKAVLDSWDSAISKK"
     MSQPLSEILT WDDEQWEVFV HDWLIVCKSD DYPWSERLGG AGDKGRDVVG YKSDPNVEGY        60
     SWDNYQCKLY KKSLGFSDVV VEFGKLIYFT LNGDYPIPQK YFFVAPYDLS TTFSNLLKNK       120
     NELKKAVLDS WDSAISKK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page