(data stored in ACNUC7421 zone)

EMBL: BA000007.PE281

BA000007.PE281       Location/Qualifiers
FT   CDS             312381..312998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33714"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33714"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7K5"
FT                   /protein_id="BAB33714.1"
FT                   /translation="MGFSNFKKITKKIDIPLDDEIKKYIEDFDFSIFYSLPLSLILNDI
FT                   ANTHLYFKYFNELYVVRIPPNEIPTYNSKKESVYVNALLQAYSEHGNKTYSSFLELDDP
FT                   YRRHFNNSRNDFYFASSLEVFVREVFKDDVFKALKCYISSSIEPVFYEDHNYAFIRCNA
FT                   VLKQAVLTPIAHSVLSKICEANDKKGICHHLVNDGEVIWTVR"
     MGFSNFKKIT KKIDIPLDDE IKKYIEDFDF SIFYSLPLSL ILNDIANTHL YFKYFNELYV        60
     VRIPPNEIPT YNSKKESVYV NALLQAYSEH GNKTYSSFLE LDDPYRRHFN NSRNDFYFAS       120
     SLEVFVREVF KDDVFKALKC YISSSIEPVF YEDHNYAFIR CNAVLKQAVL TPIAHSVLSK       180
     ICEANDKKGI CHHLVNDGEV IWTVR                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page