(data stored in ACNUC7421 zone)

EMBL: BA000007.PE285

BA000007.PE285       Location/Qualifiers
FT   CDS             complement(315956..316507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0297"
FT                   /product="phage polarity suppression protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33720"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33720"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7J0"
FT                   /protein_id="BAB33720.1"
FT                   /translation="MMARVTPDQALISFRNARILWAGHSESRKAVEQQIESLLTAMEKP
FT                   ADYARQLELQREHLDVLKWQINCAARECIYSQHQLMEACTEDALSNFMQANGAALTSAL
FT                   APFLKGRGGVDVASRILRNALVRQLAITPPEIAGDYRMILDESGVMPDPMMVRDCQSSY
FT                   TPAQQLRFQQRLDYINGMQE"
     MMARVTPDQA LISFRNARIL WAGHSESRKA VEQQIESLLT AMEKPADYAR QLELQREHLD        60
     VLKWQINCAA RECIYSQHQL MEACTEDALS NFMQANGAAL TSALAPFLKG RGGVDVASRI       120
     LRNALVRQLA ITPPEIAGDY RMILDESGVM PDPMMVRDCQ SSYTPAQQLR FQQRLDYING       180
     MQE                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page