(data stored in ACNUC7421 zone)

EMBL: BA000007.PE286

BA000007.PE286       Location/Qualifiers
FT   CDS             complement(316504..317256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0298"
FT                   /product="phage capsid size determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33721"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33721"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I9"
FT                   /protein_id="BAB33721.1"
FT                   /translation="MTIPEQNNNPIVEISIPVSTQQALEKVNATKSAWLEARRQQKAAA
FT                   DNIATIRQRRAEMEATTNALNEEWRTLFRESQGVVSKEMKKLRTEIALGRETLEDFDEL
FT                   LAAQESENALLPQEAAELAGKYIHAHDTLVGIRAKQIWEDFMQSHGKALIQTLSLLKST
FT                   MGREASAVVGVVHSVNDPDTLLKDFIHKHITRPALTNDAMPEQDPVFKLAGVAPDYAAR
FT                   LDFSNKLSPAAMHKMKVRQERAEKEKAV"
     MTIPEQNNNP IVEISIPVST QQALEKVNAT KSAWLEARRQ QKAAADNIAT IRQRRAEMEA        60
     TTNALNEEWR TLFRESQGVV SKEMKKLRTE IALGRETLED FDELLAAQES ENALLPQEAA       120
     ELAGKYIHAH DTLVGIRAKQ IWEDFMQSHG KALIQTLSLL KSTMGREASA VVGVVHSVND       180
     PDTLLKDFIH KHITRPALTN DAMPEQDPVF KLAGVAPDYA ARLDFSNKLS PAAMHKMKVR       240
     QERAEKEKAV                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page