(data stored in ACNUC7421 zone)

EMBL: BA000007.PE288

BA000007.PE288       Location/Qualifiers
FT   CDS             318447..319004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0300"
FT                   /product="phage repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33723"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33723"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I7"
FT                   /protein_id="BAB33723.1"
FT                   /translation="MMIPAYIKYLYSGLLTVVISRYSFSAVAKSAAGIGVPYNLLATID
FT                   APCVFFYVVAQAQPFSGLWCLCLHHGSIEIMVVRAGQPSGWPVSNKAGYANPVRAATSE
FT                   IGVSGGSNNRYLLEAAIMATILTPSHPQYVFVFAAIRRADTHPRICMLRTVSCDERSAR
FT                   RLLVRDYVLSLSARLPAGEVTL"
     MMIPAYIKYL YSGLLTVVIS RYSFSAVAKS AAGIGVPYNL LATIDAPCVF FYVVAQAQPF        60
     SGLWCLCLHH GSIEIMVVRA GQPSGWPVSN KAGYANPVRA ATSEIGVSGG SNNRYLLEAA       120
     IMATILTPSH PQYVFVFAAI RRADTHPRIC MLRTVSCDER SARRLLVRDY VLSLSARLPA       180
     GEVTL                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page