(data stored in ACNUC7421 zone)

EMBL: BA000007.PE289

BA000007.PE289       Location/Qualifiers
FT   CDS             319001..319222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33724"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33724"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3JCC3"
FT                   /protein_id="BAB33724.1"
FT                   /translation="MNQFEISYDDVVRLKHLRNVGEYVTGMAALQDCYEKPAGAQCEQL
FT                   VSLIYLMTEQLDGVVQRCHDDLMNAEVA"
     MNQFEISYDD VVRLKHLRNV GEYVTGMAAL QDCYEKPAGA QCEQLVSLIY LMTEQLDGVV        60
     QRCHDDLMNA EVA                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page