(data stored in ACNUC7421 zone)

EMBL: BA000007.PE290

BA000007.PE290       Location/Qualifiers
FT   CDS             319222..319545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33725"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33725"
FT                   /db_xref="GOA:Q8X7I6"
FT                   /db_xref="InterPro:IPR035317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I6"
FT                   /protein_id="BAB33725.1"
FT                   /translation="MICCESLLALRAALYRRAVACAWLALSNHQERYSGLTLAELEDAI
FT                   ARELEGFYLRQHGQQRGLEIACALLSDLMESGPLKACPVLSLLGMTVMDELCSRHLNKP
FT                   ALH"
     MICCESLLAL RAALYRRAVA CAWLALSNHQ ERYSGLTLAE LEDAIARELE GFYLRQHGQQ        60
     RGLEIACALL SDLMESGPLK ACPVLSLLGM TVMDELCSRH LNKPALH                     107
//

If you have problems or comments...

PBIL Back to PBIL home page