(data stored in ACNUC7421 zone)

EMBL: BA000007.PE292

BA000007.PE292       Location/Qualifiers
FT   CDS             complement(322025..322981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECs_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB33727"
FT                   /db_xref="EnsemblGenomes-Tr:BAB33727"
FT                   /db_xref="UniProtKB/TrEMBL:Q8X7I4"
FT                   /protein_id="BAB33727.1"
FT                   /translation="MTSYSNFSNQIKETINNKFDHEIHDWDIIKNSITTLINKNIHGAG
FT                   RNIVDFIDLGNWDFISNFSFDDSTRRLELEWHPNDKFHIYIESVVFVEFNDTIYAFLKG
FT                   YYHNQLSLNRIYNTKCSSCSFENSGSYMVDVYRTVKRVNETIQTPNINCYTTCILTRPA
FT                   NGHVTSTGFSRNLMDAINISLAEHKIASLHNEVMSIEEYDRDSLQEKGNTARRYLEYIL
FT                   MLVNIRIMHLNNVQYQEQMLGSLVSVIEALDYEPLMKNDVEITKDILNACSHHGGVRIE
FT                   KKDVIFSLEVIENLIKAIKKTDINKLQLDGMFKSIQK"
     MTSYSNFSNQ IKETINNKFD HEIHDWDIIK NSITTLINKN IHGAGRNIVD FIDLGNWDFI        60
     SNFSFDDSTR RLELEWHPND KFHIYIESVV FVEFNDTIYA FLKGYYHNQL SLNRIYNTKC       120
     SSCSFENSGS YMVDVYRTVK RVNETIQTPN INCYTTCILT RPANGHVTST GFSRNLMDAI       180
     NISLAEHKIA SLHNEVMSIE EYDRDSLQEK GNTARRYLEY ILMLVNIRIM HLNNVQYQEQ       240
     MLGSLVSVIE ALDYEPLMKN DVEITKDILN ACSHHGGVRI EKKDVIFSLE VIENLIKAIK       300
     KTDINKLQLD GMFKSIQK                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page